The metalloproteinase is a probable venom zinc protease that acts in hemorrhage (By similarity). The disintegrin inhibits fibrinogen interaction with platelet receptors expressed on glycoprotein IIb-IIIa complex. Acts by binding to the glycoprotein IIb-IIIa receptor on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen (By similarity). Disintegrin jararin (Fragment) Metalloproteinase 156 Zinc metalloproteinase/disintegrin VMJAQ_BOTJA FVANRMAHELGHNLGIDNDRDSCSCGANSCIMSATVSNEPSSRFSDCSLNQYSSDLINYYGCLLNEPLRTDIVSPPFCGNYYPEVGEDCDCGPPANCQNPCCDAATCKLTTGSQCAEGLCCDQCKFIKARQICRKGRGDNPDDRCTGQSGDCPRNS